HOXA6 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324806
| Article Name: |
HOXA6 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324806 |
| Supplier Catalog Number: |
orb324806 |
| Alternative Catalog Number: |
BYT-ORB324806-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HXA6 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti HOXA6 antibody, anti HOX1B antibody, anti antibody |
| Rabbit polyclonal antibody to HXA6 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
25kDa |
| NCBI: |
076919 |
| UniProt: |
P31267 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: YFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYT |
| Target: |
HOXA6 |
![]()
|
Sample Type: Fetal Liver lysates, Antibody Dilution: 1.0 ug/mL. |
