Dmbx1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324822
Article Name: Dmbx1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324822
Supplier Catalog Number: orb324822
Alternative Catalog Number: BYT-ORB324822-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dmbx1
Conjugation: Unconjugated
Alternative Names: anti Atx antibody, anti Cdmx antibody, anti Mbx antibody
Rabbit polyclonal antibody to Dmbx1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 41kDa
NCBI: 570935
UniProt: Q91ZK4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: SLSAAAAAHQGVWGSPLLPAPPTGLAPASAALNSKTTSIENLRLRAKQHA
Target: Dmbx1
Sample Type: Mouse Stomach lysates, Antibody Dilution: 1.0 ug/mL.