Zfp74 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324824
| Article Name: |
Zfp74 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324824 |
| Supplier Catalog Number: |
orb324824 |
| Alternative Catalog Number: |
BYT-ORB324824-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Zfp74 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti 2810054M15Rik antibody, anti KRAB8 antibody, anti Zfp66 antibody, anti Znf569 antibody, anti mszf21 antibody, anti mszf77 antibody |
| Rabbit polyclonal antibody to Zfp74 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
77kDa |
| NCBI: |
848471 |
| UniProt: |
Q80W31 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: SNCGKAFSQISSLTLHMRKHTGEKPYVCIECGKAFSQKSHLVRHQRIHTH |
| Target: |
Zfp74 |
![]()
|
Sample Type: Mouse Lung lysates, Antibody Dilution: 1.0 ug/mL. |
