Oas1g Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324855
| Article Name: |
Oas1g Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324855 |
| Supplier Catalog Number: |
orb324855 |
| Alternative Catalog Number: |
BYT-ORB324855-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti AI449562 antibody, anti L2 antibody, anti Mmu-L antibody, anti Mmu-L2 antibody, anti Oas1a antibody, anti Oias-1 antibody, anti Oias1 antibody |
| Rabbit polyclonal antibody to Oas1g |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
42kDa |
| NCBI: |
035982 |
| UniProt: |
Q8K469 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: VKGGSSGKGTTLKGRSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYE |
| Target: |
Oas1g |
|
WB Suggested Anti-Oas1g Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver. |