RDBP Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324856
Article Name: RDBP Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324856
Supplier Catalog Number: orb324856
Alternative Catalog Number: BYT-ORB324856-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RDBP
Conjugation: Unconjugated
Alternative Names: anti D6S45 antibody, anti NELF-E antibody, anti RD antibody, anti RDP antibody, anti RDBP antibody
Rabbit polyclonal antibody to NELFE
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 43kDa
NCBI: 002895
UniProt: P18615
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS
Target: NELFE
WB Suggested Anti-RDBP Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Spleen.