SRP54A Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324861
| Article Name: |
SRP54A Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324861 |
| Supplier Catalog Number: |
orb324861 |
| Alternative Catalog Number: |
BYT-ORB324861-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Rat |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti Srp54 antibody, anti Srp54a antibody |
| Rabbit polyclonal antibody to Srp54 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
55kDa |
| NCBI: |
446323 |
| UniProt: |
Q6AYB5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: DGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGL |
| Target: |
SRP54A |
|
WB Suggested Anti-Srp54a Antibody, Titration: 1.0 ug/mL, Positive Control: Rat Muscle. |