SRPRA Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324863
Article Name: SRPRA Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324863
Supplier Catalog Number: orb324863
Alternative Catalog Number: BYT-ORB324863-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRPR
Conjugation: Unconjugated
Alternative Names: anti DP antibody, anti MGC17355 antibody, anti MGC3650 antibody, anti MGC9571 antibody, anti SRP-alpha antibody, anti Sralpha antibody
Rabbit polyclonal antibody to SRPR
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 70kDa
NCBI: 003130
UniProt: P08240
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP
Target: SRPRA
WB Suggested Anti-SRPR Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.