RNMT Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324868
| Article Name: |
RNMT Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324868 |
| Supplier Catalog Number: |
orb324868 |
| Alternative Catalog Number: |
BYT-ORB324868-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human RNMT |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti DKFZp686H1252 antibody, anti KIAA0398 antibody, anti MET antibody, anti RG7MT1 antibody, anti hCMT1c antibody |
| Rabbit polyclonal antibody to RNMT |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
55kDa |
| NCBI: |
003790 |
| UniProt: |
O43148 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: RRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYF |
| Target: |
RNMT |
![]()
|
WB Suggested Anti-RNMT Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: NTERA2 cell lysate. |
