Igf2bp3 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: Igf2bp3 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324884
• Supplier Catalog Number: orb324884
• Alternative Catalog Number: BYT-ORB324884-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Conjugation: Unconjugated
• Alternative Names: anti 2610101N11Rik antibody, anti AA522010 antibody, anti AL022933 antibody, anti AU045931 antibody, anti IMP-3 antibody, anti IMP3 antibody, anti Koc13 antibody, anti MGC61294 antibody, anti Neilsen antibody, anti mimp3 antibody

Product Description

Rabbit polyclonal antibody to Igf2bp3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 63kDa
• NCBI: 076159
• UniProt: Q9CPN8
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI
• Target: Igf2bp3

Images

WB Suggested Anti-Igf2bp3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Mouse Kidney.