Csdc2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324896
| Article Name: |
Csdc2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324896 |
| Supplier Catalog Number: |
orb324896 |
| Alternative Catalog Number: |
BYT-ORB324896-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti AI415250 antibody, anti AI481750 antibody, anti Pippin antibody |
| Rabbit polyclonal antibody to Csdc2 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
18kDa |
| NCBI: |
001171094 |
| UniProt: |
Q9DCB4 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: VWPTFPFHREGSRIWERGGGIAPRDLPSPLPTKRTRTYSATARASAGPVF |
| Target: |
Csdc2 |
![]()
|
WB Suggested Anti-Csdc2 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Heart. |
