PCBP3 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324914
Article Name: PCBP3 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324914
Supplier Catalog Number: orb324914
Alternative Catalog Number: BYT-ORB324914-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCBP3
Conjugation: Unconjugated
Alternative Names: anti ALPHA-CP3 antibody
Rabbit polyclonal antibody to PCBP3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 36kDa
NCBI: 065389
UniProt: P57721
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
Target: PCBP3
WB Suggested Anti-PCBP3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate.