RBM18 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324930
Article Name: RBM18 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324930
Supplier Catalog Number: orb324930
Alternative Catalog Number: BYT-ORB324930-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBM18
Conjugation: Unconjugated
Alternative Names: anti MGC2734 antibody
Rabbit polyclonal antibody to RBM18
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 22kDa
NCBI: 149108
UniProt: Q96H35
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKL
Target: RBM18
WB Suggested Anti-RBM18 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.