ADAD2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324935
Article Name: ADAD2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324935
Supplier Catalog Number: orb324935
Alternative Catalog Number: BYT-ORB324935-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAD2
Conjugation: Unconjugated
Alternative Names: anti FLJ00337 antibody, anti TENRL antibody
Rabbit polyclonal antibody to ADAD2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 71kDa
NCBI: 631913
UniProt: Q8NCV1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP
Target: ADAD2
WB Suggested Anti-ADAD2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Liver.