DRB1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324940
Article Name: DRB1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324940
Supplier Catalog Number: orb324940
Alternative Catalog Number: BYT-ORB324940-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DRB1
Conjugation: Unconjugated
Alternative Names: anti DRB1 antibody
Rabbit polyclonal antibody to RBM45
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 36kDa
NCBI: 694453
UniProt: Q8IUH3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD
Target: RBM45
WB Suggested Anti-DRB1 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.