GOLGB1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325275
Article Name: GOLGB1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325275
Supplier Catalog Number: orb325275
Alternative Catalog Number: BYT-ORB325275-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOLGB1
Conjugation: Unconjugated
Alternative Names: anti GCP antibody, anti GCP372 antibody, anti GIANTIN antibody, anti GOLIM1 antibody
Rabbit polyclonal antibody to GOLGB1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 376 kDa
NCBI: 004478
UniProt: Q14789
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
Target: GOLGB1
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 4 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human uterus tissue labelling Giantin with orb325275 at 5 ug/mL.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-GOLGB1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, GOLGB1 is supported by BioGPS gene expression data to be expressed in 721_B.