METTL16 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325358
Article Name: METTL16 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325358
Supplier Catalog Number: orb325358
Alternative Catalog Number: BYT-ORB325358-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human METTL16
Conjugation: Unconjugated
Alternative Names: anti METT10D antibody
Rabbit polyclonal antibody to METTL16
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 63kDa
NCBI: 076991
UniProt: Q86W50
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: QGRTMRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLASVMKELSL
Target: METTL16