ZBED9 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: ZBED9 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB325359
• Supplier Catalog Number: orb325359
• Alternative Catalog Number: BYT-ORB325359-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human ZNF452
• Conjugation: Unconjugated
• Alternative Names: anti DKFZp434N092 antibody, anti FLJ31087 antibody, anti KIAA1925 antibody, anti MGC131782 antibody, anti MGC133310 antibody, anti MGC133311 antibody, anti SCAND3 antibody, anti ZFP38-L antibody, anti ZNF305P2 antibody, anti dJ1186N24.3 antibody, anti ZNF452 antibody

Product Description

Rabbit polyclonal antibody to SCAND3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 89kDa
• NCBI: 941180
• UniProt: Q6R2W3
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SRQRFRQFCYQETPGPREALSQLRELCRQWLNPEIHTKEQILELLVLEQF
• Target: ZBED9