Zkscan6 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325361
| Article Name: |
Zkscan6 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325361 |
| Supplier Catalog Number: |
orb325361 |
| Alternative Catalog Number: |
BYT-ORB325361-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Zkscan6 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti 1700128E15Rik antibody, anti D11Ertd714e antibody, anti KOX11 antibody, anti Zfp535 antibody, anti Znf18 antibody |
| Rabbit polyclonal antibody to Zkscan6 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
63kDa |
| NCBI: |
080383 |
| UniProt: |
Q810A1 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: FSGLRHHEKIHTGEKPYKCPLCEKSFIQRSNFNRHQRVHTGEKPYKCTHC |
| Target: |
Zkscan6 |
