THG1L Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325370
| Article Name: |
THG1L Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325370 |
| Supplier Catalog Number: |
orb325370 |
| Alternative Catalog Number: |
BYT-ORB325370-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human THG1L |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti FLJ11601 antibody, anti FLJ20546 antibody, anti ICF45 antibody |
| Rabbit polyclonal antibody to THG1L |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
35kDa |
| NCBI: |
060342 |
| UniProt: |
Q9NWX6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY |
| Target: |
THG1L |
