Eve Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: Eve Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB325372
• Supplier Catalog Number: orb325372
• Alternative Catalog Number: BYT-ORB325372-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Drosophila
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Fruit fly
• Conjugation: Unconjugated
• Alternative Names: anti Dmel_CG2328 antibody, anti 10.5 antibody, anti 10.9 antibody, anti 14.10 antibody, anti 20.35 antibody, anti CG2328 antibody, anti E(eve) antibody, anti EVE antibody, anti F antibody, anti V antibody, anti VI antibody, anti eve2 antibody, anti l(2)46Ce antibody, anti Dmel\CG2328 antibody, anti Eve antibody, anti l(2)46CFg antibody, anti l(2)46CFh antibody, anti l(2)46CFj antibody, anti l(2)46CFp antibody, anti l(2)46Cg antibody

Product Description

Rabbit polyclonal antibody to eve

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 40kDa
• NCBI: 523670
• UniProt: P06602
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS
• Target: eve