Antp Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: Antp Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB325376
• Supplier Catalog Number: orb325376
• Alternative Catalog Number: BYT-ORB325376-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Drosophila
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Fruit fly
• Conjugation: Unconjugated
• Alternative Names: anti Dmel_CG1028 antibody, anti 3.4 antibody, anti ANT-C antibody, anti ANT-P antibody, anti Ant antibody, anti AntP antibody, anti AntP1 antibody, anti CG1028 antibody, anti DMANTPE1 antibody, anti DRO15DC96Z antibody, anti DmAntp antibody, anti Hu antibody, anti Scx antibody, anti l(3)84Ba antibody, anti ANTC antibody, anti antp antibody, anti ANTP antibody, anti Antp P1 antibody, anti Antp P2 antibody, anti Antp1 antibody, anti Aus antibody, anti BG:DS07700.1 antibody, anti Dmel\CG1028 antibody, anti Ns antibody

Product Description

Rabbit polyclonal antibody to Antp

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 33kDa
• NCBI: 996176
• UniProt: P02833
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
• Target: Antp