Exd Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: Exd Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB325377
• Supplier Catalog Number: orb325377
• Alternative Catalog Number: BYT-ORB325377-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Drosophila
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Fruit fly
• Conjugation: Unconjugated
• Alternative Names: anti Dmel_CG8933 antibody, anti CG8933 antibody, anti DExd antibody, anti Dm-EXD antibody, anti Dpbx antibody, anti EXD antibody, anti td48 antibody, anti unnamed antibody, anti anon-EST:fe1H3 antibody, anti Dmel\CG8933 antibody, anti Exd antibody, anti l(1)IV antibody, anti Pbx1 antibody

Product Description

Rabbit polyclonal antibody to exd

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 42kDa
• NCBI: 727924
• UniProt: P40427
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA
• Target: exd