LDHB Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325389
| Article Name: |
LDHB Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325389 |
| Supplier Catalog Number: |
orb325389 |
| Alternative Catalog Number: |
BYT-ORB325389-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDHB |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti LDH-H antibody, anti TRG-5 antibody, anti LDH-B antibody, anti LDHBD antibody |
| Rabbit polyclonal antibody to LDHB |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
37kDa |
| NCBI: |
002291 |
| UniProt: |
P07195 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
| Target: |
LDHB |
