PSMA8 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325398
Article Name: PSMA8 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325398
Supplier Catalog Number: orb325398
Alternative Catalog Number: BYT-ORB325398-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PSA7L
Conjugation: Unconjugated
Alternative Names: anti PSMA8 antibody, anti PSMA7L antibody, anti antibody
Rabbit polyclonal antibody to PSA7L
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 28kDa
NCBI: 653263
UniProt: Q8TAA3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: KLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDDDGISRL
Target: PSMA8