POLRMT Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325408
| Article Name: |
POLRMT Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325408 |
| Supplier Catalog Number: |
orb325408 |
| Alternative Catalog Number: |
BYT-ORB325408-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human POLRMT |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti APOLMT antibody, anti MTRNAP antibody, anti MTRPOL antibody, anti h-mtRPOL antibody |
| Rabbit polyclonal antibody to POLRMT |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
135kDa |
| NCBI: |
005026 |
| UniProt: |
O00411 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: ALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLE |
| Target: |
POLRMT |
