PGDS Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325412
Article Name: PGDS Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325412
Supplier Catalog Number: orb325412
Alternative Catalog Number: BYT-ORB325412-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PGDS
Conjugation: Unconjugated
Alternative Names: anti GSTS antibody, anti PGDS antibody
Rabbit polyclonal antibody to HPGDS
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 23kDa
NCBI: 055300
UniProt: O60760
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKI
Target: HPGDS