TRMU Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325419
Article Name: TRMU Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325419
Supplier Catalog Number: orb325419
Alternative Catalog Number: BYT-ORB325419-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRMU
Conjugation: Unconjugated
Alternative Names: MTO2, MTU1, TRMT, LCAL3, TRMT1
Rabbit polyclonal antibody to TRMU
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 41kDa
UniProt: O75648
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSC
Target: TRMU