ALG13 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325424
| Article Name: |
ALG13 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325424 |
| Supplier Catalog Number: |
orb325424 |
| Alternative Catalog Number: |
BYT-ORB325424-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti RP1-298J18.2 antibody, anti CXorf45 antibody, anti GLT28D1 antibody, anti MDS031 antibody, anti YGL047W antibody |
| Rabbit polyclonal antibody to ALG13 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
18kDa |
| NCBI: |
060936 |
| UniProt: |
Q9NP73 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: CVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLK |
| Target: |
ALG13 |
