PNPLA5 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325432
| Article Name: |
PNPLA5 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325432 |
| Supplier Catalog Number: |
orb325432 |
| Alternative Catalog Number: |
BYT-ORB325432-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human PNPLA5 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti 4833426H19Rik antibody, anti GS2L antibody, anti dJ388M5 antibody, anti dJ388M5.4 antibody |
| Rabbit polyclonal antibody to PNPLA5 |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
48kDa |
| NCBI: |
620169 |
| UniProt: |
Q7Z6Z6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL |
| Target: |
PNPLA5 |
