METTL6 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325436
Article Name: METTL6 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325436
Supplier Catalog Number: orb325436
Alternative Catalog Number: BYT-ORB325436-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human METTL6
Conjugation: Unconjugated
Alternative Names: anti MGC24132 antibody
Rabbit polyclonal antibody to METTL6
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 33kDa
NCBI: 689609
UniProt: Q8TCB7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML
Target: METTL6