TMTC2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325439
Article Name: TMTC2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325439
Supplier Catalog Number: orb325439
Alternative Catalog Number: BYT-ORB325439-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TMTC2
Conjugation: Unconjugated
Alternative Names: IBDBP1
Rabbit polyclonal antibody to TMTC2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 65kDa
NCBI: 689801
UniProt: Q8N394
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: YLNTGIILMNQGRTEEARRTFLKCSEIPDENLKDPHAHKSSVTSCLYNLG
Target: TMTC2