STRADB Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325452
Article Name: STRADB Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325452
Supplier Catalog Number: orb325452
Alternative Catalog Number: BYT-ORB325452-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human STRAB
Conjugation: Unconjugated
Alternative Names: anti STRADB antibody, anti ALS2CR2 antibody, anti ILPIP antibody, anti PRO1038 antibody, anti antibody
Rabbit polyclonal antibody to STRAB
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 41kDa
UniProt: Q9C0K7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFK
Target: STRADB