TMEM126B Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325472
| Article Name: |
TMEM126B Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325472 |
| Supplier Catalog Number: |
orb325472 |
| Alternative Catalog Number: |
BYT-ORB325472-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human TMEM126B |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti HT007 antibody, anti MGC111203 antibody |
| Rabbit polyclonal antibody to TMEM126B |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
23kDa |
| NCBI: |
060950 |
| UniProt: |
A8K535 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC |
| Target: |
TMEM126B |
