CSGALNACT2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325473
Article Name: CSGALNACT2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325473
Supplier Catalog Number: orb325473
Alternative Catalog Number: BYT-ORB325473-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CGAT2
Conjugation: Unconjugated
Alternative Names: anti CSGALNACT2 antibody, anti CHGN2 antibody, anti GALNACT2 antibody, anti PRO0082 antibody, anti antibody
Rabbit polyclonal antibody to CGAT2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 59kDa
NCBI: 005271877
UniProt: Q8N6G5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PGVVGENYGKEYYQALLQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMR
Target: CSGALNACT2