FLJ20674 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325477
Article Name: FLJ20674 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325477
Supplier Catalog Number: orb325477
Alternative Catalog Number: BYT-ORB325477-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20674
Conjugation: Unconjugated
Alternative Names: anti FLJ20674 antibody, anti MGC1013 antibody
Rabbit polyclonal antibody to VSIG10
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 59kDa
NCBI: 061959
UniProt: Q8N0Z9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS
Target: VSIG10