C15orf24 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325478
| Article Name: |
C15orf24 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325478 |
| Supplier Catalog Number: |
orb325478 |
| Alternative Catalog Number: |
BYT-ORB325478-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human C15orf24 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti C11orf3 antibody, anti HT022 antibody, anti ORF1-FL1 antibody, anti C15orf24 antibody |
| Rabbit polyclonal antibody to EMC7 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
26kDa |
| NCBI: |
064539 |
| UniProt: |
Q9NPA0 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD |
| Target: |
EMC7 |
