C16orf58 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325507
Article Name: C16orf58 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325507
Supplier Catalog Number: orb325507
Alternative Catalog Number: BYT-ORB325507-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C16orf58
Conjugation: Unconjugated
Alternative Names: anti FLJ13868 antibody
Rabbit polyclonal antibody to C16orf58
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 51kDa
NCBI: 073581
UniProt: Q96GQ5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN
Target: C16orf58