ELOVL1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB325508
Article Name: ELOVL1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB325508
Supplier Catalog Number: orb325508
Alternative Catalog Number: BYT-ORB325508-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELOV1
Conjugation: Unconjugated
Alternative Names: anti ELOVL1 antibody, anti SSC1 antibody, anti CGI-88 antibody, anti antibody
Rabbit polyclonal antibody to ELOV1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 30kDa
NCBI: 073732
UniProt: Q9BW60
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMV
Target: ELOVL1