MGC4172 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325513
| Article Name: |
MGC4172 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325513 |
| Supplier Catalog Number: |
orb325513 |
| Alternative Catalog Number: |
BYT-ORB325513-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human MGC4172 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ARPG836 antibody, anti FLJ39232 antibody, anti SDR24C1 antibody, anti MGC4172 antibody |
| Rabbit polyclonal antibody to DHRS11 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
28kDa |
| NCBI: |
077284 |
| UniProt: |
Q6UWP2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR |
| Target: |
DHRS11 |
