Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Target:
HNRNPH1
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPH1 ppt. k562 sample, IP Antibody: HNRPH1, Amount of IP Antibody, Primary Antibody: HNRPH1, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.
Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
IHC Information: Paraffin embedded testis tissue, tested with an antibody Dilution of 5 ug/mL.
Lanes: Lane 1: 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.
WB Suggested Anti-HNRPH1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, HNRNPH1 is supported by BioGPS gene expression data to be expressed in HepG2.
* VAT and and shipping costs not included. Errors and price changes excepted