GABRP Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: GABRP Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB327620
• Supplier Catalog Number: orb327620
• Alternative Catalog Number: BYT-ORB327620-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP
• Conjugation: Unconjugated

Product Description

Rabbit polyclonal antibody to GABRP

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 51 kDa
• NCBI: 055026
• UniProt: O00591
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE
• Target: GABRP

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): Human esophagus (ES), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/mL.

WB Suggested Anti-GABRP Antibody, Titration: 1.25 ug/mL, Positive Control: HepG2/Jurkat.