SLC1A2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: SLC1A2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB329749
• Supplier Catalog Number: orb329749
• Alternative Catalog Number: BYT-ORB329749-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A2
• Conjugation: Unconjugated
• Alternative Names: anti EAAT2 antibody, anti GLT-1 antibody

Product Description

Rabbit polyclonal antibody to SLC1A2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 62kDa
• NCBI: 004162
• UniProt: P43004
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK
• Target: SLC1A2

Images

Anti-SLC1A2 / EAAT2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC1A2 Antibody orb329749 concentration 5 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Fetal Brain lysates, Antibody Dilution: 1.0 ug/mL.

Sample Type: Fetal Brain, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Rabbit Anti-SLC1A2 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-SLC1A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.