GNAS Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: GNAS Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB330252
• Supplier Catalog Number: orb330252
• Alternative Catalog Number: BYT-ORB330252-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
• Conjugation: Unconjugated
• Alternative Names: anti AHO antibody, anti C20orf45 antibody, anti GNAS1 antibody, anti GPSA antibody, anti GSA antibody, anti GSP antibody, anti MGC33735 antibody, anti PHP1A antibody, anti PHP1B antibody, anti POH antibody, anti dJ309F20.1.1 antibody, anti dJ806M20.3.3 antibody, anti NESP antibody, anti PHP1C antibody

Product Description

Rabbit polyclonal antibody to GNAS

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 46 kDa
• NCBI: 000507
• UniProt: P63092
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
• Target: GNAS

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 46 kDa is present as well as a second isoform around 111 kDa.

Anti-GNAS antibody IHC staining of human thyroid. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.

Lane 1: INS1 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Donkey anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Gene Name: GNAS.

Rabbit Anti-GNAS Antibody, Paraffin Embedded Tissue: Human Pancreas, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-GNAS Antibody Titration: 1 ug/mL, Positive Control: MCF-7 Whole Cell, lysate, sGNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.