Sumo3 antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Sumo3 antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: BYT-ORB330452
• Supplier Catalog Number: orb330452
• Alternative Catalog Number: BYT-ORB330452-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Sumo3
• Conjugation: Unconjugated
• Alternative Names: anti 2810014B19Rik antibody, anti AA409334 antibody, anti AW121497 antibody, anti AW536077 antibody, anti D10Ertd345e antibody, anti SMT3A antibody, anti SUMO-3 antibody, anti Smt3h1 antibody, anti Smt3B antibody

Product Description

Rabbit polyclonal antibody to Sumo3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 12kDa
• NCBI: 064313
• UniProt: Q9Z172
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMR
• Target: Sumo3