DLL1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB330489
Article Name: DLL1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB330489
Supplier Catalog Number: orb330489
Alternative Catalog Number: BYT-ORB330489-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DLL1
Conjugation: Unconjugated
Alternative Names: anti DELTA1 antibody, anti Delta antibody, anti DL1 antibody
Rabbit polyclonal antibody to DLL1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 78 kDa
NCBI: 005609
UniProt: O00548
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
Target: DLL1
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.
Anti-DLL1 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.
Anti-DLL1 antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.
Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Positive control (+): Mouse spleen (M-SP), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/mL.
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-DLL1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.