UCHL1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: UCHL1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB331031
• Supplier Catalog Number: orb331031
• Alternative Catalog Number: BYT-ORB331031-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1
• Conjugation: Unconjugated
• Alternative Names: anti-Epididymis luminal protein 117 antibody, anti-HEL 117 antibody, anti-HEL S 53 antibody, anti-NDGOA antibody, anti-Neuron cytoplasmic protein 9.5 antibody, anti-Park 5 antibody, anti-PARK5 antibody, anti-PGP 9.5 antibody, anti-PGP9.5 antibody, anti-PGP95 antibody, anti-Protein gene product 9.5 antibody, anti-Ubiquitin C terminal esterase L1 antibody, anti-Ubiquitin C terminal hydrolase antibody, anti-Ubiquitin C terminal hydrolase L1 antibody, anti-Ubiquitin carboxyl terminal esterase L1 antibody, anti-Ubiquitin thioesterase L1 antibody, anti-Ubiquitin thiolesterase antibody, anti-UCH-L1 antibody, anti-UCHL1 antibody, anti-UCHL 1 antibody

Product Description

Rabbit polyclonal antibody to PGP9.5

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 25kDa
• NCBI: 004172
• UniProt: P09936
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
• Target: UCHL1

Images

orb331031

orb331031

orb331031

orb331031

Sample Type: 1. Rat brain cells (100 ug), 2. Rat Brain cells (100 ug) incubatde with HA-UbVME, Band a: unmodified HA-UbVME, Band b: modified UCHL1, Primary dilution: 1:1000, Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit, Secondary dilution: 1:1000.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 75000 rat INS cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: UCHL1.

WB Suggested Anti-UCHL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.