Human BTN3A3 protein

Catalog Number: BYT-ORB358074
Article Name: Human BTN3A3 protein
Biozol Catalog Number: BYT-ORB358074
Supplier Catalog Number: orb358074
Alternative Catalog Number: BYT-ORB358074-1,BYT-ORB358074-100,BYT-ORB358074-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: BT3A3_HUMAN, BTF3, BTN3A3, Butyrophilin subfamily 3 member A3
Recombinant human BTN3A3 protein
Molecular Weight: 39.6 kDa
UniProt: O00478
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Application Notes: Full length of Extracellular domain of His-SUMO-tag and expression region is 30-248aa