Human MME protein

Product Overview

• Article Name: Human MME protein
• Biozol Catalog Number: BYT-ORB358244
• Supplier Catalog Number: orb358244
• Alternative Catalog Number: BYT-ORB358244-1,BYT-ORB358244-100,BYT-ORB358244-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: AtriopeptidaseCommon acute lymphocytic leukemia antigen , CALLAEnkephalinaseNeutral endopeptidase 24.11 , NEP , Neutral endopeptidase, Skin fibroblast elastase , SFE, CD10

Product Description

This Human MME protein spans the amino acid sequence from region 52-750aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 81.8 kDa
• UniProt: P08473
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTLA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) MME.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) MME.