Viral Scytovirin protein

Product Overview

• Article Name: Viral Scytovirin protein
• Biozol Catalog Number: BYT-ORB358269
• Supplier Catalog Number: orb358269
• Alternative Catalog Number: BYT-ORB358269-1,BYT-ORB358269-100,BYT-ORB358269-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Scytovirin, SVN

Product Description

This Viral Scytovirin protein spans the amino acid sequence from region 1-95aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 11.7 kDa
• UniProt: P86041
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Scytonema varium
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA

Application Notes

• Application Notes: Biological Origin: Scytonema varium. Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Scytonema varium.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Scytonema varium.