Viral KP6 killer toxin protein

Catalog Number: BYT-ORB358275
Article Name: Viral KP6 killer toxin protein
Biozol Catalog Number: BYT-ORB358275
Supplier Catalog Number: orb358275
Alternative Catalog Number: BYT-ORB358275-1,BYT-ORB358275-100,BYT-ORB358275-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: KP6 killer toxin, Killer protein 6) [Cleaved into, KP6 killer toxin subunit alpha, VP10), KP6 killer toxin subunit beta, VP12.5)]
This Viral KP6 killer toxin protein spans the amino acid sequence from region 28-105aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 10.6 kDa
UniProt: P16948
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Ustilago maydis P6 virus (UmV6) (UmV-P6)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS
Application Notes: Biological Origin: Ustilago maydis P6 virus (UmV6) (UmV-P6). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Ustilago maydis P6 virus (UmV6) (UmV-P6).
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Ustilago maydis P6 virus (UmV6) (UmV-P6).